Chemical Structure & Technical Specifications
| Product Name: | Calcitonin Salmon |
| Synonyms: | salmoncalcitonin-(i-32);salmoncalcitonini;tz-ct;Salmon Calcitonin Acetate;Salcatonin;CALCITONIN SALMON 250 UG;CalcitoninAcetate;Salmon Calcium |
| CAS: | 47931-85-1 |
| MF: | C145H240N44O48S2 |
| MW: | 3431.85 |
| EINECS: | 256-342-8 |
| Product Categories: | Amino Acid Derivatives;Peptide;Calcitonin and CGRP receptor;47931-85-1 |
| Mol File: | 47931-85-1.mol |
Calcitonin Salmon - High Purity Peptide Raw Material | Factory Wholesale Supplier
Calcitonin Salmon is a high-activity synthetic polypeptide raw material with powerful bone metabolism regulation and calcium ion metabolism adjustment functions. Compared with human calcitonin, salmon calcitonin features higher biological activity, better stability, and longer half-life, making it one of the core raw materials for bone disease treatment drugs. As a reliable China-based manufacturer and wholesale supplier, we provide high-purity Calcitonin Salmon powder with strict quality control, factory direct price, and global one-stop export service for pharmaceutical factories, biotech companies, and scientific research institutions worldwide.
Our Calcitonin Salmon is produced in accordance with international GMP production standards, with ultra-low impurity content, stable biological activity, and strict batch consistency. It is widely used in pharmaceutical preparation production and biomedical research, enjoying a high reputation among global bulk buyers.
98% Pure CAS: 47931-85-1 pure Calcitonin Acetate Salmon
Name: Calcitonin Acetate(Salmon)
Cas No: 47931-85-1(net)
Formula: C145H240N44O48S2
Molecular: 3431.85
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
Pramlintide, Pramlintide acetate [USAN],187887-46-3,196078-30-5.
Purity:98%
Source: synthetic
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Brand Name: Yinherb
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C.
Product COA
Certificate Of Analysis
|
Product Name |
Calcitonin Salmon Powder |
|
||
|
Chemical Formula |
C145H240N44O48S2 |
Molecular Weight |
3431.85 | |
|
CAS |
47931-85-1 |
Batch Quantity |
400KG |
|
|
Batch No. |
MLP-PPH-20231114 |
Manufacture Date |
2025.11.14 |
|
|
Report Date |
2025.11.17 |
Retest Date |
2027.11.13 |
|
|
Testing Items |
Specifications | Test Results | |
|
BP2010 /EP6 |
Appearance |
crystalline powder |
Conforms |
|
Melting point |
About 205°C |
206.4°C~206.7°C |
|
|
Identification |
Meet the requirements |
Conforms |
|
|
Appearance of solution |
Clear, not more intense than Y7 |
Conforms |
|
|
PH |
2.4~3.0 |
2.60 |
|
|
Loss on drying |
≤0.5% |
0.04% |
|
|
Sulphated ash |
≤0.1% |
0.01% |
|
|
Heavy metals |
≤20 ppm |
<20 ppm |
|
|
Related substances |
≤0.25% |
Conforms |
|
|
Assay |
99.0%~101.0% |
99.8% |
|
|
USP32 |
Identification |
Meet the requirements |
Conforms |
|
Loss on drying |
≤0.5% |
0.04% |
|
|
Residue on ignition |
≤0.1% |
0.01% |
|
|
Heavy metals |
≤0.003% |
<0.003% |
|
|
Residue solvent - Ethanol |
≤0.5% |
<0.04% |
|
|
Chloride |
16.9%~17.6% |
17.1% |
|
|
Assay |
98.0%~102.0% |
100.0% |
|
|
Conclusion: The product complies with BP2010/USP32/EP6 standard |
|||
Basic Product Specifications
|
Item |
Specification |
|
Product Name |
Calcitonin Salmon |
|
CAS Number |
47931-85-5 |
|
Purity |
≥98.0% (HPLC Tested) |
|
Appearance |
White or Off-White Lyophilized Powder |
|
Molecular Formula |
C145H240N44O48S2 |
|
Molecular Weight |
3432.04 Da |
|
Solubility |
Soluble in Water and Dilute Acid |
|
Grade |
Pharmaceutical Grade / Research Grade |
|
Storage Condition |
Sealed, -20℃ Low Temperature, Dry and Dark Environment |
|
Shelf Life |
36 Months Under Standard Storage |
Core Functions & Pharmacological Mechanism
Calcitonin Salmon is a biologically active polypeptide hormone that specifically regulates human bone and calcium-phosphorus metabolism. It can effectively inhibit the activity of osteoclasts, reduce bone resorption, slow down bone loss, and significantly reduce blood calcium and blood phosphorus levels. Compared with mammalian calcitonin, Calcitonin Salmon has stronger binding affinity with human calcitonin receptors, delivering more stable and durable pharmacological effects with low drug resistance.
Its core functional advantages are summarized as follows:
Inhibit Bone Resorption: Suppress osteoclast proliferation and activity, prevent excessive bone tissue decomposition, and effectively improve bone density.
Relieve Bone Pain: Block pain signal transmission of bone lesions, rapidly relieve moderate and severe bone pain caused by osteoporosis and bone metastasis.
Regulate Calcium Metabolism: Reduce elevated blood calcium levels caused by hypercalcemia, maintain human calcium metabolism balance, and protect skeletal system health.
High Biological Activity: Unique salmon peptide chain structure ensures higher activity and better human body adaptability with fewer side effects.
Main Applications
With its stable activity and high safety, Calcitonin Salmon is an indispensable key raw material in the pharmaceutical and biotech industry, widely applied in multiple fields:
Raw material for osteoporosis treatment drugs (injection, nasal spray, lyophilized preparation)
Auxiliary drugs for hypercalcemia caused by tumor and metabolic diseases
Therapeutic preparations for Paget's disease of bone and bone dystrophy
Biomedical research on bone metabolism and endocrine regulation
New drug development and pharmacological experiment research in biotech laboratories
Note: This product is a professional pharmaceutical peptide raw material, only for industrial pharmaceutical production and scientific research use, not for direct human or animal medication. Unauthorized personal use is prohibited.
Our Product & Supply Advantages
High Purity & Stable Activity: All Calcitonin Salmon products adopt advanced peptide synthesis and purification technology, HPLC tested purity ≥98%, stable biological activity, no residual impurities, fully compliant with international pharmaceutical raw material standards.
Direct Factory Supply: Professional peptide raw material production base, no middlemen profit margin, sufficient raw material stock, support trial small orders and large-scale bulk customization to reduce your procurement costs.
Complete Quality Certification: Strictly implement GMP production management, each batch of products is accompanied by complete COA, HPLC, mass spectrometry and activity test reports, with traceable product quality.
Rich Export Experience: Long-term supply to Europe, North America, Southeast Asia, Middle East and other global markets, proficient in international trade rules, support FOB, CIF, DDP and other diversified trade terms.
Customized Service Support: Support customized specifications, special packaging and personalized testing services, provide professional technical after-sales support to meet diverse customer procurement and research needs.
Packaging & Global Shipping
Lab Sample Packaging: 10mg, 50mg, 100mg vacuum-sealed bottle packaging, suitable for experimental testing and R&D verification
Bulk Industrial Packaging: 1g, 5g, 10g aluminum foil vacuum packaging and professional low-temperature drum packaging
Shipping Solution: Samples are delivered via DHL/FedEx/UPS international express with fast arrival; bulk goods are shipped by air or sea with professional low-temperature cold chain transportation to ensure product activity stability during transit. Sample delivery takes 3-7 working days, bulk order delivery takes 7-15 working days.
Get Free Sample & Custom Wholesale Quotation
As a professional manufacturer and wholesale supplier of Calcitonin Salmon, we provide free sample testing services, competitive factory bulk prices and full-range technical support for global pharmaceutical manufacturers, biotech enterprises and research institutions. Whether you need small trial orders for laboratory research or mass procurement for pharmaceutical production, we can provide official batch test reports, complete product parameter documents and customized procurement solutions.
We always adhere to quality stability, standardized inspection and sincere win-win cooperation, committed to providing global customers with high-quality Calcitonin Salmon peptide raw materials and reliable one-stop supply services.
Other Nootropics Raw Material Also Available
| Tianeptine sodium salt | 99% | 30123-17-2 |
| Tianeptine Acid | 99% | 66981-73-5 |
| Noopept | 99% | 157115-85-0 |
| Alpha-gpc | 99%/50% | 28319-77-9 |
| 5-HTP | 99% | 56-69-9 |
| CDP-Choline | 99% | 987-78-0 |
| Oxiracetam | 99% | 62613-82-5 |
| NSI-189 | 99% | 1270138-40-3 |
| Sunifiram | 99% | 314728-85-3 |
| Unifiram | 99% | 272786-64-8 |
| Pramiracetam | 99% | 68479-62-1 |
| Piracetam | 99% | 7491-74-9 |
| Agomelatin | 99% | 138112-76-2 |
Packaging & Shipping
Delivery Time:Around 3-5 workdays after your payment.
Package:1kg/aluminium foil bag;25Kgs in fiber-drums with two-plastic bags inside
Net Weight:25kgs/Drum/Gross Weight:28kgs/Drum
Drum Size & Volume:I.D.42cm × H52cm,0.08 m³/Drum
Storage:Stored in dry and cool place,keep away from strong light and heat.
Shelf Life:Two years when properly stored.
|
Package |
1kg/bag ,25kg/bag;25kg/drum; customize as customer's equirements. |
|||
|
Transit |
Fedex, TNT,DHL,EMS,and so on. |
|||
|
Shipping port |
Shanghai/Tianjin/Dalian/Beijing/Xi'an |
|||
|
Lead Time |
1-2 working days upon received the payment |
|||
|
For mass orders, it will be delivered by air or sea. |
||||
FAQ
Q: 1. I want to know more details about the product, how can I contact you?
A: You can send us an email inquiry at any time. For more accurate quotes, I need the following information: product name, order quantity, receipt country, quality requirements, etc.
Q: 2. How do I know if your products are real or fake?
A: We will inspect every shipment. I can provide test reports including HPLC, MS and HNMR if you want. Please find a professional chemist to help you confirm the authenticity of the test report.
Of course, you can also purchase samples to take you around your trust.
Q: 3. How do you ensure the safety of the package I receive?
A: I want to receive the package safely, I first need to know your delivery address, do you have a preferred courier method, did you buy it from China?
Why do you want to know?
Because each country has different requirements for imported packages, especially chemical products, you need to know the basic information to provide you with the safest choice.
At present, we have professional customs clearance agents in EU countries, the United States, the United States, Canada, and Southeast Asia. We have professional customs clearance agents to ensure the safety of packages.
Q: 4. How to pay?
A: Our payment channels include bittoin, bank card, Western Union, Allegitudes, etc.
It is usually recommended that customers pay with Bitcoin, because the fee is low, the entry speed is fast, and the security is guaranteed.
Q: 5. How long does it take to receive the package?
A: This will vary according to the delivery method you choose. I will briefly introduce our commonly used special lines.
Usually European countries 10-15 days after sending you the tracking number.
In the United States and Canada, it usually takes 7-10 days.
Southeast Asian countries are 3-7 days.
Hot Tags: effective peptides salmon calcitonin acetate, China effective peptides salmon calcitonin acetate manufacturers, suppliers, factory, Loratadine Powder Bulk, Tetrahydrocurcumin for Anti inflammatory Benefits, Tetrahydrocurcumin for Wrinkle Reduction, Tianeptine Sodium Salt for Anxiety Relief, Zinc Bacitracin for Animal Health, Zinc Bacitracin for Wound Disinfection
